PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo18G0000800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family TALE
Protein Properties Length: 480aa    MW: 52172.1 Da    PI: 6.6133
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo18G0000800genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.21.3e-084034411854
                      HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  Spipo18G0000800 403 MFQNflHPYPKDSEKHLLAIKSGLTRSQVSNWFINARVR 441
                      5887779******************************88 PP

2BELL52.51.2e-17278343772
             BELL   7 kkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                        k+ L++lle Vd+ Y+++  q+q v+  F+a+     a+  ++lAl aiSr +r+L+d+i++qi
  Spipo18G0000800 278 VEKTDLITLLEAVDNGYNRCLVQMQSVMTKFQAASSAAVAHTPARLALSAISRLHRSLRDKITSQI 343
                      6799*************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.9E-4198341IPR006563POX domain
PfamPF075263.0E-21206340IPR006563POX domain
PROSITE profilePS5007111.451382445IPR001356Homeobox domain
CDDcd000861.19E-11385446No hitNo description
Gene3DG3DSA:1.10.10.604.4E-26385459IPR009057Homeodomain-like
SMARTSM003891.4E-5385449IPR001356Homeobox domain
SuperFamilySSF466892.99E-15386453IPR009057Homeodomain-like
PfamPF059202.1E-14402441IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MVGPEMRASR ESSLPSASFD GLLPGNPNLQ DDIIGAAIPA VSVLSSEDIR TFISNNSSSN  60
STSVTCAYGV EEMEFSGPRR YVDASGQLNF AGSYGEVMGH QVLPGRSLAT VRPSCHILSG  120
SSFIPEKTYS YSALNNELSL TLGSSQSSIM NLHGVPDQIS EDSRCGEASE LLVCPQIVSH  180
SGNDAGPGIR RGARDHHSRV VGHPWESRYV PIVEEVLAEV ASYALENLSE LDDPSVWIED  240
GTRASFSSSC SSERGASALA NSKDFAHSPG DAMSHDHVEK TDLITLLEAV DNGYNRCLVQ  300
MQSVMTKFQA ASSAAVAHTP ARLALSAISR LHRSLRDKIT SQILSAGEHP GGGRGEAAEK  360
ERSFESSIQT QWASQQLRRN DQQTWRPQRG LPEKSVSVLR AWMFQNFLHP YPKDSEKHLL  420
AIKSGLTRSQ VSNWFINARV RLWKPMIEEM HSEVSKKNQS QEVPGDRRGR PCAGGQRVG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-15391448158Homeobox protein Meis1
4xrs_B2e-15391448158Homeobox protein Meis1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31433365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.13e-61homeobox gene 1